SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X6X2U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6X2U0
Domain Number 1 Region: 8-162
Classification Level Classification E-value
Superfamily LigT-like 2.96e-25
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X6X2U0
Sequence length 180
Comment (tr|A0A1X6X2U0|A0A1X6X2U0_9MICO) Uncharacterized protein {ECO:0000313|EMBL:SLM92838.1} KW=Complete proteome; Reference proteome OX=946573 OS=Brevibacterium yomogidense. GN=FM105_03355 OC=Brevibacterium.
Sequence
MTSPDNILLRLPPAEEQQVREVFARLAERGFPPQQQTPHITITYSPIMAADAVRRAADLL
PSVIPSPFRRVGTVVFGTKRKRTVAWLLETTDAMESAAREISALNPESRGRSWTPHLTMG
LRLPREIVPDYIRALDEVTSPHFKQLTAVRAAHWMPRIQELTVLADASSEHRRDHRETDR
Download sequence
Identical sequences A0A1X6X2U0
WP_087004720.1.56095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]