SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7S4Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7S4Q2
Domain Number 1 Region: 180-296
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.83e-37
Family eIF-2-alpha, C-terminal domain 0.0000357
Further Details:      
 
Domain Number 2 Region: 90-176
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.35e-31
Family eIF2alpha middle domain-like 0.0000528
Further Details:      
 
Domain Number 3 Region: 10-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.79e-16
Family Cold shock DNA-binding domain-like 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X7S4Q2
Sequence length 307
Comment (tr|A0A1X7S4Q2|A0A1X7S4Q2_ZYMTR) Uncharacterized protein {ECO:0000313|EMBL:SMQ54490.1} KW=Complete proteome; Reference proteome OX=1276538 OS=Zymoseptoria tritici ST99CH_3D7. GN=ZT3D7_G9645 OC=Zymoseptoria.
Sequence
MSLTNCRFYEEKYPEIDSFVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQ
KLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDIIKCEERYNKSKMVHSIMRHVAEKAN
VPIEELYQDIGWPLNKKYGHAVDAFKLSITNPDVWSEVKFKNNVIRDELQSYIGKRLTPQ
PTKVRADIEVTCFGYEGIDAVKRALRCAEAKSTEDTQVKVRLVSPPLYVLTCTTVDKSNG
IEVLEEAIREVDASIKNEMGTCMVKMAPKAVTENDDAELQALMDKKEKENMEVSGDEDSE
SEDNVVA
Download sequence
Identical sequences A0A1X7S4Q2 A0A1Y6LUT3 A0A2H1GZB1 A0A2H1HAC7 F9XL14
XP_003848775.1.87952 jgi|Mycgr1|86868|estExt_fgenesh2_pg.C_120082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]