SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7SM20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7SM20
Domain Number 1 Region: 257-494
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-69
Family Ankyrin repeat 0.0000427
Further Details:      
 
Weak hits

Sequence:  A0A1X7SM20
Domain Number - Region: 60-76,215-282
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.034
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X7SM20
Sequence length 495
Comment (tr|A0A1X7SM20|A0A1X7SM20_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.03065_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
VSLEEEAQVIPKTPESHPELKLDPEAEKTISKSIKDLSSSFNALLKNLKNELKEVDIADV
VEYLEENGLDYLPFDDLKTAKDFRDFINKVNEHYDFLDCSLLQLIAEEFATDALSEKFEE
HSNVAAEFRESHTVDDLKYNLTEIFNPYLDDFEKGPIARIDLNNAWNGVQLSRLRTLIGC
FFPDIKIKRALTKHVLIKCRSVHITYYMTESADQIQQIIACARERVDFMKHIGLYHLAIN
GEVILNEAEKKDFKFESALQEAAKVGDSEAVEVLLEIGRGTDVLGDISKALFHASSNNHY
RVVKLFLNEGANPNVRDTDGESAMHAASRKGHHKIVELLLKEKADPNTCSNNGITTLMLA
SFNNCYQVIKLLLKEKVNPNIQTKNGTTALMLASQSGHTESAELLLKAGADPDIKEEEGW
TALMIACQSDHTKVAQLLLENKADPNICSNDGRTALMSASFNNCHQVVELLLKEKVDPNI
QSKNGWTALMLASQS
Download sequence
Identical sequences A0A1X7SM20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]