SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7SUK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7SUK8
Domain Number 1 Region: 2-26,316-392
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.22e-21
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 117-223,278-391
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000034
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X7SUK8
Sequence length 392
Comment (tr|A0A1X7SUK8|A0A1X7SUK8_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.05781_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MLASIGGHIEIFNSLLQNGANPFVQLPANKGCIGLNYLACTALSEHIYKSIGGEIIIPRD
GTLVEDMLEMAVKERGVSSHFYKPFMQVIKNKIKEKFQWLQDCFRALNSNFIDTATNILI
SKALVTEAKQKFQSYIKEDATCENVHQLVQLLQPHYSCLNINLLTIPCTITEPIKEQAEE
YNTNLKLFKDTTSLLELAMMTKGMQYPDGVVGCSKLILRLNKPWCSRTIAELNKLETFYL
SPILLSVNLIKTHYDASSFHCIYFFPQSSQTESLIEEVFQQSSFLYAIGVFEVMIDDIPI
MMEEKNESFTFEAALQELISLPLENGNTALILASEKRDFLSVQFLLSKDPDINIQNNDGW
TALMSATANRHHQVVELLLSKDPDMNIQDKNG
Download sequence
Identical sequences A0A1X7SUK8
Aqu1.203917|PACid:15702445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]