SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7U183 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7U183
Domain Number 1 Region: 73-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.59e-17
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 2 Region: 279-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000623
Family Nucleotide and nucleoside kinases 0.01
Further Details:      
 
Domain Number 3 Region: 187-216
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000968
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.002
Further Details:      
 
Domain Number 4 Region: 31-66
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000128
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X7U183
Sequence length 372
Comment (tr|A0A1X7U183|A0A1X7U183_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.21242_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MATGSNTLQIKMEDVTIDATKKLNIPVKYPNYAEKHHIFDLFQHMLQELLLHRPNDPISF
LQDLLRRPTDVPGIVIYGPPASGQNTLSKLIARKLRLVHIKPTILLEENENGGSDKQELI
EDALPDKLASLIYERLQRADSKAKGWIMEGYPRTREQALALQGRGILVKHFVLLEGPDPV
LIERYAGKRVDSVTGDVYHVIFSPPDDPRVAERLVEEKGGVQFHMHSKLEAYHRHSEQML
KCYADVTKRFCCDQPIQDLLVAVSLFLDTRERTMSPHIPRVVLLGPTGSGKSLQAAQLAE
KYRIVNVDCSHLLKQVLASGSTLGQQMKPFHDKHMPSTSSNNNNAMNVFSIDDLASTVAC
TVRDLKKQITPT
Download sequence
Identical sequences A0A1X7U183
XP_019856689.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]