SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7U8F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7U8F1
Domain Number 1 Region: 9-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000209
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X7U8F1
Sequence length 406
Comment (tr|A0A1X7U8F1|A0A1X7U8F1_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.23731_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MSVSYAAAKIRIPAGFEHILEGLVREVLREQPEDVIAFSAEYFNKKILLRKGGYAEESKS
AGQQIEEAKNVHVKEEPAVEVEEKHDPTAELEEEKKNDESVPPQEGDETQATKDEQEEEG
EKEVEQETAPHESSEASQEPAVITQEGDASHEPSQNEGESNQEEPQMDIEPQTTEESQAT
EDQKPSEEPQSSEEPQPSEEPQEPQPSEEPQPSEEPQPSEEPQPSEEPQPSEEPQPSEEP
QATEEPEVPQPSEEPQATEEPQPSEEPQATEEPQATEESQPSEEPQATKEPQATEDSQQS
EEPQATEASEEPPPETEEPQATEEPQATEEPQATEEPQATEEPQATEEPQATEEPQATEE
PQATEEPQATEEPQPTEETQPSEEQKQETTAEEPSGASEDSKPEES
Download sequence
Identical sequences A0A1X7U8F1
XP_003388784.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]