SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7V0L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7V0L8
Domain Number 1 Region: 235-350
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 4.84e-49
Family USP8 interacting domain 0.00000598
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000189
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 87-144
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000268
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 
Weak hits

Sequence:  A0A1X7V0L8
Domain Number - Region: 137-179
Classification Level Classification E-value
Superfamily Prefoldin 0.0575
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X7V0L8
Sequence length 350
Comment (tr|A0A1X7V0L8|A0A1X7V0L8_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.33496_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MGYEVERFVGVVDEELFCPICGLVLDSPLQIKDCEHCFCGSCIEEWLKHQRVCPVDRTPV
PPSCEGSSLTSALGPAPRILRNLLSRLRIKCENEVFGCQTVTHLEGLQLHLNQCEYNPRR
PVECDRGCGSVVPMDELTQHNCIKELREKITNQSLVIKTLSDQVSILQQELSDQRQEMTI
LKELVRSSASSSSNSLRHTLSLLPPLPPLSSASPSSVSSSQSNYPDEVEHAIQTSQWLSL
LRPARIRHWGGIISTPDSILQSIIRQALSSSGCPQYLLVELMANAHERRWPPGLSVLETR
QLNRSRYEQYVTKQVPGKQAVVIMASENEHMGDNMIVSPGMVIIFAHGVD
Download sequence
Identical sequences A0A1X7V0L8
XP_011403536.1.10788 Aqu1.222033|PACid:15720561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]