SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X9KVW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1X9KVW9
Domain Number - Region: 40-74
Classification Level Classification E-value
Superfamily AbfB domain 0.0575
Family AbfB domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X9KVW9
Sequence length 90
Comment (tr|A0A1X9KVW9|A0A1X9KVW9_9INFA) PB1-F2 protein {ECO:0000313|EMBL:ARI69039.1} OX=1978631 OS=Influenza A virus (A/Passo Fundo/LACENRS-1533/2013(H3N2)). GN=PB1-F2 OC=Orthomyxoviridae; Influenzavirus A.
Sequence
MEQGQGTLWTQSTGHTNIQRGGSGRQIQKLGRPSSTQLMDHYLRIMNQVDMHKQTVSWRL
WPSLKNPTQVSLRTHALKQWKPFNRQGWTN
Download sequence
Identical sequences A0A075CAK7 A0A075SR63 A0A1X9KVW9 A0A2D3QR20 V9T1H1 X2ERM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]