SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y0CMY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y0CMY5
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000000000034
Family BAS1536-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y0CMY5
Sequence length 53
Comment (tr|A0A1Y0CMY5|A0A1Y0CMY5_9BACI) Sporulation protein Spo0E {ECO:0000313|EMBL:ART76444.1} KW=Complete proteome OX=79883 OS=Bacillus horikoshii. GN=B4U37_10505 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MATKHELIELIEKKRSELIDIVAKYGMSSSKTLKLSQELDTLLNKYNHIIVPK
Download sequence
Identical sequences A0A1Y0CMY5
WP_010193472.1.38069 WP_010193472.1.82924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]