SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1HNC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1HNC0
Domain Number 1 Region: 266-326,384-406
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000785
Family Pseudo ankyrin repeat 0.024
Further Details:      
 
Domain Number 2 Region: 107-296
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000696
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1HNC0
Sequence length 563
Comment (tr|A0A1Y1HNC0|A0A1Y1HNC0_KLENI) Uncharacterized protein {ECO:0000313|EMBL:GAQ78679.1} KW=Complete proteome; Reference proteome OX=105231 OS=Klebsormidium nitens (Green alga) (Ulothrix nitens). GN=KFL_000170250 OC=Klebsormidiales; Klebsormidiaceae; Klebsormidium.
Sequence
MSVEEDTLRRLRNIDSWLTALQPDGHKYTEKGISTLQEYRPTYSNIGFPRAAIDNEHFDV
VDYLSKKDVLVRELVFPLAALLESLNGLKWAKVQGMYQWGEDSCQHAVLGGSLEVLQWLR
EQTPPCPWDATLCIALAAQMKSFAIAEWVLGQDPSAGKTLCNVAAKAGFLDALAWARKHG
LPWDEGVCTGAAMRGQFAALRWLRKRSPPCPWHPSLCAFFAAEEKQFEMAQWVLKKARSA
APSVCAYAACLGSMHVLEWARKRKLEWGNDACVTAAMYGQLDTLKWLRAHGCPWEAGRCA
FEAINHGRLEEAEWIVEQEEDALADMCILAAMMGKLPPLVWASKRVPPSSWEKDVCLYAA
RAGSLKILTWARSQVPPSPWNPLRCIYGACARGHNEVADWVLKQEPMVRPFVCDIAAARG
EVQALRWARSLDPPCPWDLERCLRSAALEGVSDQELLSILEAEPVVQLSREYCAEVAKED
RIHMLRFLLDRGCYRYVLRPGLNAGPLCARLARKMLVPLDKESTKRASDMFKRQVALSAG
LQTYGIFGDVAEKIGLLAELSWL
Download sequence
Identical sequences A0A1Y1HNC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]