SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1I374 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1I374
Domain Number 1 Region: 4-78
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.05e-29
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1I374
Sequence length 103
Comment (tr|A0A1Y1I374|A0A1Y1I374_KLENI) Signal recognition particle SRP9/SRP14 subunit {ECO:0000313|EMBL:GAQ85385.1} KW=Complete proteome; Reference proteome OX=105231 OS=Klebsormidium nitens (Green alga) (Ulothrix nitens). GN=KFL_002320190 OC=Klebsormidiales; Klebsormidiaceae; Klebsormidium.
Sequence
MVYIESWDEFAEKAEMLFRAEPLRTRYCVKYRHREGLLVLKVTDDKVCLKFKTDQAQDAK
KMEKLNTLFFTLMTKGENAPAPEDVVMPDVQQAPPSKKGRGRK
Download sequence
Identical sequences A0A1Y1I374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]