SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1IT05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1IT05
Domain Number 1 Region: 87-303
Classification Level Classification E-value
Superfamily RNI-like 4.97e-19
Family 28-residue LRR 0.054
Further Details:      
 
Domain Number 2 Region: 414-501
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000131
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1IT05
Sequence length 687
Comment (tr|A0A1Y1IT05|A0A1Y1IT05_KLENI) Uncharacterized protein {ECO:0000313|EMBL:GAQ93222.1} KW=Complete proteome; Reference proteome OX=105231 OS=Klebsormidium nitens (Green alga) (Ulothrix nitens). GN=KFL_013700010 OC=Klebsormidiales; Klebsormidiaceae; Klebsormidium.
Sequence
MALADSSLLLRWLDSPDEEPFPMPEERRVGNLLRHCCESGEVPEELLEVLPNVSSLLVEE
QWTQVLADFGFEKLSSLTSYQQTSGYHASLRNFDQLVRLNKLIIRVNPADFESLAESLRN
FSQLKFLSLRYNNILRREAEMLAAALPSLSALETLDLSACSIGWVAYHEFLCRAKDEPKA
DPKTWKILLVALAKVGSLRMLNLSKNNLRGEAGKVLASHLPSLRQLSVLVIGDGQCDCLF
DNRITSKHVYSALLQMTSLDTLGTPSRDEIDVGFSDLDSLFALPMNRLRFKTIGTLWLEQ
ALERHAEAGNLETLESWCQADEKRVWRLRAEQGTVFRSTEFTVRGDHDLLDKLCTAAAKG
GQLPVIEWTEAKGLLRYYHCDQFISPAAASRAHLHILQWLKKKGCLGGRYNKNTCSAAAY
DGHLAVLQWARANGVGWDKQTCASAAAGGHMEWATENGCPWGEDIGEVAAECGRVDILQW
LAANGLQWSTDICAAAAAGGHLNVLEWACKEINWWVDVWDEATCDRALEEGRKVVFLWAL
EQGCPWSGSTLDMDNLPWILEYAKDAFWNLFLDDQKRLSDFVAMAAEDDDVDTFRQLREG
YERRSEDESSEEITPHMLKTGPKCAQVLLQEGYTSADLDPATVLHLEQALYCQTIAGVVL
KHRVGLPREVMLKIFELANFVWLEDRV
Download sequence
Identical sequences A0A1Y1IT05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]