SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1KIU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1KIU8
Domain Number 1 Region: 49-148
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-21
Family Hormone receptor domain 0.00076
Further Details:      
 
Domain Number 2 Region: 109-271
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000632
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1KIU8
Sequence length 286
Comment (tr|A0A1Y1KIU8|A0A1Y1KIU8_PHOPY) Uncharacterized protein {ECO:0000313|EMBL:JAV59535.1} OX=7054 OS=Photinus pyralis (Common eastern firefly) (Lampyris pyralis). GN= OC=Elateriformia; Elateroidea; Lampyridae; Lampyrinae; Photinus.
Sequence
MDLELELANLPQDSRDLLIEMGLNNNSHLINVEFPDFNSSDKKDLFDLYCKIKHKDNENF
TNLGEGKYCNASSDLVLCWPPTPANTTAYLKCFSEFLGYKYDDRENASRECLWNGTWSKS
DYSFCWDITEEPTEENFFTTSTIYFVGYTLSLVALSIAIGIFIYFKDLRCLRNTIHTNLM
CAYILVYALWIVTLIVEQTFQTDMVLCVILVFLLHYFHVTTFFWMFVEGLYLYILVVETL
TRENFKLRIYATIGWGLPFVFVLIWAITKSFIETDSWVGDYLARFE
Download sequence
Identical sequences A0A1Y1KIU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]