SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1N0U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1N0U9
Domain Number 1 Region: 8-86
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 7.72e-27
Family Inhibitor of apoptosis (IAP) repeat 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1N0U9
Sequence length 108
Comment (tr|A0A1Y1N0U9|A0A1Y1N0U9_PHOPY) Uncharacterized protein {ECO:0000313|EMBL:JAV90500.1} OX=7054 OS=Photinus pyralis (Common eastern firefly) (Lampyris pyralis). GN= OC=Elateriformia; Elateroidea; Lampyridae; Lampyrinae; Photinus.
Sequence
MCLEDGAADYTNFEDRLLSFHSWVGVPSAVELANAGFFYTHSGDTVECFYCKVRINKWEA
SDVPLAEHLRWSSRCRYARLLNRMACLKINETEKTYCVCGCSPGAHLI
Download sequence
Identical sequences A0A1Y1N0U9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]