SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1USL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1USL1
Domain Number 1 Region: 88-172
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.5e-25
Family Skp1 dimerisation domain-like 0.0000559
Further Details:      
 
Domain Number 2 Region: 9-71
Classification Level Classification E-value
Superfamily POZ domain 8.11e-20
Family BTB/POZ domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1USL1
Sequence length 186
Comment (tr|A0A1Y1USL1|A0A1Y1USL1_9TREE) SconCp {ECO:0000313|EMBL:ORX40991.1} KW=Complete proteome; Reference proteome OX=4999 OS=Kockovaella imperatae. GN=BD324DRAFT_574626 OC=Tremellomycetes; Tremellales; Cuniculitremaceae; Kockovaella.
Sequence
MSAEKKDSVILQTSDDEQFTVEKKVAERSAMIKSMLEDLPSQDSMIPLPNVSSSVLAKVL
EYCDHHKNEPLPAADADADDSRKKTSEIGDWDSNLSQVDQEMLFEIILAANYLDIKPLLD
VGCKTVKLTTDQSLSSNMIKGKSPEQIRTLFNIQNDFTPEEEEQIRKENEWAEEWVQNRK
SDGLAC
Download sequence
Identical sequences A0A1Y1USL1
XP_021874670.1.66562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]