SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1V3M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1V3M3
Domain Number 1 Region: 183-314
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-33
Family cAMP-binding domain 0.0000237
Further Details:      
 
Domain Number 2 Region: 310-433
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-31
Family cAMP-binding domain 0.0000938
Further Details:      
 
Domain Number 3 Region: 10-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1V3M3
Sequence length 452
Comment (tr|A0A1Y1V3M3|A0A1Y1V3M3_9FUNG) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1754191 OS=Piromyces finnis. GN=BCR36DRAFT_399139 OC=Neocallimastigales; Neocallimastigaceae; Piromyces.
Sequence
MDNKENKELSADSEEILKELEKELLEHQPQDVVQFCATYFHYKLKEQRAQLISLAQSYSE
SYNNNNENENENDEASQEDEEEEMEDALENMSESAATSEKQDASSNTGSVSEDEKEEEQD
TVGSLSKSKNMDVNDHIETESEDETMDLPPPPPVNYNRGRRTSVSAESMAPTTDKNYVKV
IIPKTQEQRKRIQVSISNNFLFKNLDEEQYTDVVNAMSEKRAVNGDIVIKQGGVGDFFYV
VETGTLDIYISKNGNPPIKVGDYGAGASFGELALMYNAPRAATITATSDCILWALDRITF
RKILMENTSRKRKMYEIFLEEVPLLQSLEPYERHKIADALESVTYNDGEIVIKQGDVGEN
FYLIESGEAAVLQEDDEGIVREISTLHKGEYFGELALLTDKPRAATIKAKGKIKCATLGK
KAFTRLLGPVVDIIKRNTANYNIISQNHQIVF
Download sequence
Identical sequences A0A1Y1V3M3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]