SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1V5I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1V5I3
Domain Number 1 Region: 154-613
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.65e-43
Family Ankyrin repeat 0.0000676
Further Details:      
 
Domain Number 2 Region: 727-1071
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.38e-39
Family Ankyrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 7-209
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-25
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 626-684
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000902
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1V5I3
Sequence length 1073
Comment (tr|A0A1Y1V5I3|A0A1Y1V5I3_9FUNG) Ankyrin {ECO:0000313|EMBL:ORX46874.1} KW=Complete proteome; Reference proteome OX=1754191 OS=Piromyces finnis. GN=BCR36DRAFT_356282 OC=Neocallimastigales; Neocallimastigaceae; Piromyces.
Sequence
MNILKDIINNNTENVKKIFKNNKKINILEKNEDGSGSLLCAIKNNNLEITKLIINYANAE
GIILNINEKNNEKYFPLLWAIRNNNVEITELIMEYANSRNIILDINGKDNNGKYPLLWII
EKNYKEISKLLIKYANDKNIMINVNEKDRYEWYPVSLAANNNSIENMELLINYTKEKNII
LNINENSFDDETPISICINKNYFDIIKLLIQYANEKNIILKNLMIKYENGEYPIQWAIRN
DKMEITKLLIAYSNIRNKPLYINEKNEKNEYPLYWAVRNNNIEMMELLIKYAKDNDIELK
LNERTKDGSFPLLWAIRNNNIEILKKLIDSIDNKDLLYINEGDEDGYPIYWAVHNNNIEI
VKLLVKFALESKIDLKINEKGKGGWYPFLSGIKNNNPEILKLLINYAKESHFKLEIEEIN
EINKGWYPLILAIENGNIENIKLIINYADNANNYYNKPLNIERRNEKGDFPLLLAIKNNK
YDIIELLIDYAKTWKIESTIINKKYSIDDENSYNNTFPLLYSIKNNNTKITKLLIEHTNT
EYINEKNKNGEYPLYWAVRNNNIEIIETLIKQATHENISLIINEKDKDEWYPLLWALENN
NIEITKLLMDYAKEKNIKLLITEKNKKKLFPLLLAIHNDNMEMIKLLIDYAASQNIRLYI
NQNQIKQCKNSNTDVLEMLKQNKITNDFELDVSVDETFSRENNTFLQTFNKVIKDIELYK
KDPENKNIELNINIKNQDGWYPLLFAIRNNNVGNVKSLIEYAKDNNMILEFNEKNKDGWY
PLLLAVRNNNIEIFDLLKEYAEKNNITLNVNEKDQNENYPLLTAIHDNNEEIVKLLHDYA
NKNEIPLDINGKDKSGNYPFLSAIKNNNIKILNLLIEYAEKNNITLNVNEKDQNENYPLL
TAIHHNNEEIVKLLYDYVNKNGISLDINEKDKSGNYPFLSAIKNNNIKILDLLIEYAEEN
NITLNVNEKYKKGMYPFLHAINNYDIAEKIMKYSHKKKIILDINEKNDTGNFPLLLSISN
NNIDTLKLLIEYANENQIILNINNKNNNGEYPLLLSTKNDKKEIVNILINYAN
Download sequence
Identical sequences A0A1Y1V5I3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]