SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1W6M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1W6M1
Domain Number 1 Region: 141-273
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-34
Family cAMP-binding domain 0.0000306
Further Details:      
 
Domain Number 2 Region: 266-391
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-33
Family cAMP-binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 14-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000759
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1W6M1
Sequence length 413
Comment (tr|A0A1Y1W6M1|A0A1Y1W6M1_9FUNG) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=61395 OS=Linderina pennispora. GN=DL89DRAFT_224219 OC=Kickxellaceae; Linderina.
Sequence
MDSEKTTLSENHAEYEAEIIEVLGELREAVFRRQPSDIYQFCATYFNEKLAEQREGLLEL
ASSHAWSEGVPAEAANGLLNPDFSFGAAMEEDETDEARDKFSRLVHLPPNSAVQPFAGRR
FSVSAESMNPTTEAEFERKFVPKTESQKQRIRQALSNNFLFKNLDEDAYRDVVDAMEEKQ
VAAGQDIITQGGVGDFFYIVERGSFDIFVTKGDEPPSKVATAGDGGSFGELALMYNAPRA
ATVHATTAATLWALDRITFRRLLMERTSRKRRLYERFLETVPLLKSLEPYERQKIADALE
SITFNDGDVVVRQGDKGDAFYLIEQGTVRVIKADQDGVEREYPSLDQGGYFGELALLDDQ
PRQATLVAQGRTKCARMSKDAFDRLLGPVINIIRREAGNYTRIQSLGQAHLDH
Download sequence
Identical sequences A0A1Y1W6M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]