SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1WQ22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1WQ22
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.00000000694
Family Hevein-like agglutinin (lectin) domain 0.023
Further Details:      
 
Domain Number 2 Region: 97-138
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.00000000766
Family Hevein-like agglutinin (lectin) domain 0.015
Further Details:      
 
Domain Number 3 Region: 47-90
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000000232
Family Hevein-like agglutinin (lectin) domain 0.018
Further Details:      
 
Domain Number 4 Region: 148-187
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000000232
Family Hevein-like agglutinin (lectin) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1WQ22
Sequence length 188
Comment (tr|A0A1Y1WQ22|A0A1Y1WQ22_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORX75620.1} KW=Complete proteome; Reference proteome OX=1754192 OS=Anaeromyces robustus. GN=BCR32DRAFT_210153 OC=Neocallimastigales; Neocallimastigaceae; Anaeromyces.
Sequence
CPSDQCCSKYGYCGTSSDYCDISSGCQSEFGECTNNIIKTSTVKGMCGKEYGKCPSGQCC
SKYGHCGTTSEYCTISTGCQSEFGECQIDIVSPVIGRCGKDYGNCPLGKCCSKYGYCGTT
ADYCNATKGCQSEYGMCVINFISVSGKCGVQYGKCPSGQCCNKDGYCGTGENYCNVGCQS
RFGICNTV
Download sequence
Identical sequences A0A1Y1WQ22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]