SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1WV71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1WV71
Domain Number 1 Region: 25-81,132-171
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000811
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1WV71
Sequence length 171
Comment (tr|A0A1Y1WV71|A0A1Y1WV71_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORX77403.1} KW=Complete proteome; Reference proteome OX=1754192 OS=Anaeromyces robustus. GN=BCR32DRAFT_60472 OC=Neocallimastigales; Neocallimastigaceae; Anaeromyces.
Sequence
MDFIVKAIEKKKINKIKLLINNNNKRDILYEMYDKNELSEKKLKFIIEKCSNYLYISTPL
IERLIKEDNYQLFSIIIENLNFFDNKFILNILLFHYKNKTPISTSDLKQQISKYKFKLNK
YNIYRRNTCGNYLEEACSCGNENVFFFLIRHGIVRKNENIFGETLLFEACR
Download sequence
Identical sequences A0A1Y1WV71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]