SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1XKV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1XKV0
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000089
Family Txnl5-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1XKV0
Sequence length 129
Comment (tr|A0A1Y1XKV0|A0A1Y1XKV0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORX86380.1} KW=Complete proteome; Reference proteome OX=1754192 OS=Anaeromyces robustus. GN=BCR32DRAFT_290103 OC=Neocallimastigales; Neocallimastigaceae; Anaeromyces.
Sequence
MKTVQITEIPKFDEVMKEQVETGNPVFAVFLSDIDPETKQYWCPDCVQADPYIKKALSNV
ENAILVECFVGPKSGYKNVPTHPYRVHPQVQLKAIPTIMFWNKDGPAKKLIIETIEQCET
LDDFVKSCI
Download sequence
Identical sequences A0A1Y1XKV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]