SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1YL31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1YL31
Domain Number 1 Region: 483-572
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000034
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1YL31
Sequence length 643
Comment (tr|A0A1Y1YL31|A0A1Y1YL31_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORX98719.1} KW=Complete proteome; Reference proteome OX=1314790 OS=Basidiobolus meristosporus CBS 931.73. GN=K493DRAFT_313546 OC=Basidiobolomycetes; Basidiobolales; Basidiobolaceae; Basidiobolus.
Sequence
MSDLLGLPLRVLEDILAFSDSLVVWTWVSRDLRQLILSSTGLKTRWLIYTYLRARSQFSP
KETTWLDRNEQQSNGSEEASSNQRLVEDILDGGDSELALLYWRQYQSDYSFEEDLTTYGR
WLRADPYHNHGFISNFYKCLPRNPAFLDEEVVKLLAKEHRYRYEEMFDSILLAAVRDNNP
STLSLILHDSPDPQVIKRFPLAYSIGVGAREVTLMMLKEFRVGYTMCHAIACIKEGDLET
LECMIHRSPHKSDIWDGIFCGFMRAFGLGLARGSQQAIQLTLDTLVCPNSRISFGLDSWE
MHPNARQSLKLEPWKSVLKQICLCACDVQIFDFTMDACARLSRVGRTVWCEEALLACSLF
YPHHFTSTLVSHLLSTGVNPNASDGLALWNTGFNFTNGGYSEYERWTYGVLPIDQQEVTR
KTYVQLAVILLKSGLLVTEKLLGKMVSAGFHKFLQTLLEEDQLPPLSHSRSLLGIALDAR
FSSNTMIRFLLDNGVAAEPSHFLLCVSKGQLDIVRMIYEHMQTIEETTLAQALEISVKRV
HLEVVEFLLEKGVSIETLLHGFSVSYVATGSMVETQGVVRFHQDGIRVDFGESDWSTNNW
QDYVFLKMMRMLGTTWVRIQGVKNVDIRISRQNTNERFTIRRT
Download sequence
Identical sequences A0A1Y1YL31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]