SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1ZAA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1ZAA9
Domain Number 1 Region: 165-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-34
Family cAMP-binding domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 289-413
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-30
Family cAMP-binding domain 0.00014
Further Details:      
 
Domain Number 3 Region: 9-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1ZAA9
Sequence length 428
Comment (tr|A0A1Y1ZAA9|A0A1Y1ZAA9_9FUNG) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1314790 OS=Basidiobolus meristosporus CBS 931.73. GN=K493DRAFT_344121 OC=Basidiobolomycetes; Basidiobolales; Basidiobolaceae; Basidiobolus.
Sequence
MSSNDNLDLTPHGFADIIQNLHEKVVQAQPKDLYQFCADYFQHKLQEQRAELLSLTMQTS
GWQQVSQSLHMTEFAEESSDQLNVPTEIDRVLDESDEEAFVSGQESFGSTTFHHTVHSDM
EDELEDELGSLPPMPPVRDRGRRTSVSAESMAPTGDADYEKIVIEKTPEQRQRIESSIAK
NFLFSNLDEEQYRDVVNAMSEKKVQNGEVIIQQGGIGDYFYVVDSGSFDCFVSKNGGEPQ
KVTDYIPGGSFGELALMYNAPRAATIVATSDSVLWALDRVTFRRMLMERTNSKRRMFESF
LEEVPLLVSLEPYERYKIADALEPLNFEDGEVVIRQGDVGENFFIIESGEAKVTKDDSDD
VFPTLKKGDYFGELALLNDKPRAATITAHGRLKVVTLGKKAFVRLLGPVVEIIRRNTANY
KVISRHVE
Download sequence
Identical sequences A0A1Y1ZAA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]