SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2ABX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2ABX8
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000196
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2ABX8
Sequence length 136
Comment (tr|A0A1Y2ABX8|A0A1Y2ABX8_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORY20069.1} KW=Complete proteome; Reference proteome OX=1754190 OS=Neocallimastix californiae. GN=LY90DRAFT_161927 OC=Neocallimastigales; Neocallimastigaceae; Neocallimastix.
Sequence
MPINSVEINKRIREIFRDNDINEFRQFIRNNNLQIKDLNNENFDILVFSIENDASINIIE
YIICKCKYKTLNYIVNEYPEYKRKTPLLSAIGRSNFKVANYLIEYGADINYIVNDERKQI
LNIYKNVKYVLYKELF
Download sequence
Identical sequences A0A1Y2ABX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]