SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2B458 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2B458
Domain Number 1 Region: 187-351
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-31
Family cAMP-binding domain 0.0000657
Further Details:      
 
Domain Number 2 Region: 344-472
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-27
Family cAMP-binding domain 0.0002
Further Details:      
 
Domain Number 3 Region: 5-37
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2B458
Sequence length 486
Comment (tr|A0A1Y2B458|A0A1Y2B458_9TREE) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=71784 OS=Naematelia encephala. GN=BCR39DRAFT_531877 OC=Tremellomycetes; Tremellales; Naemateliaceae; Naematelia.
Sequence
MSTSWTELLNELNRDVSREQPKDVVQWGSDWFQARLKRDRMSTSGTSNVPLKRGPPGSLS
AFSALPSHDLSQAPHTPSPFSETGPSDNPFGGPRRATVPTGSNNVNTGAPIFSAPFGAAP
AREASPFGDVPSFAANPFGQAQSAPSAEEQQDEPPVPSYALGRRTSVSAESLVPTNQRGP
ALSNGLETTMEEDETTPNQGSTAIPVFPKTEEQLARIKSAIKPNFLFRNLDEEQEADVLA
AMNEVTIPAGEMIIEQGAAGDYFYVVESGKLDVFVKRDGQVLDPEKGDKPALGKKVATCT
EGNSFGELALMHNAPRAASIISLTPCNLWALDRVSFRTILLDHTSRKRRLYESFLAEVPI
LASLQPQERAKIADVLESRTFTEGEAVITEGDAGEEFFLIESGSAVAIKKDASGQEIVVK
QLVKGDYFGELALLNHQTRAATVRAEGAEKLRVAALGEQAFTRLLGPVKDIMARNVGERY
GFAAGR
Download sequence
Identical sequences A0A1Y2B458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]