SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2CD58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2CD58
Domain Number 1 Region: 185-245,273-392
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.55e-16
Family Ankyrin repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 104-215
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000085
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2CD58
Sequence length 432
Comment (tr|A0A1Y2CD58|A0A1Y2CD58_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORY44754.1} KW=Complete proteome; Reference proteome OX=329046 OS=Rhizoclosmatium globosum. GN=BCR33DRAFT_208452 OC=Chytriomycetaceae; Rhizoclosmatium.
Sequence
MEEEERSPPPKPTLTTLPYEILAMILRKLTIQRRVSVLSSNKYLYTSQSLHSELIFRERP
FRFEYLAASGNTAHLLLHHGQVVTRLNECTECSRDTLALLPYLNSKLYSIAARNGMLEFM
VLLRKLHPGVALSRGMIDDAAEGGHLEVIQALVGGDSRLCVDSLVGGGGGGQERILDWRG
FTKGNALSRAAAEGHLETVQWVLEHSVGLVSVDEDRERRKVVLREAVDLAAGNGHLEVVE
WVVGVWVRDMGDVVVGSTGIGVQEGKKKPTAVPVVPYEERNLPCTSKALDMAAKNGHFPV
VQYLHKVLQAPCTKAAMDQAAGHGHLEIVQFLHRYRNEGGTAKGMDFACLRNHLSVVKWL
HENRKEGCTIDALNYAASRGNLKIVQFLVKCRREGKVSDAIKFSQKGGHSAVTGFLLDCE
KRGSSANGKGRR
Download sequence
Identical sequences A0A1Y2CD58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]