SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2CKX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2CKX0
Domain Number 1 Region: 354-389
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000732
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2CKX0
Sequence length 392
Comment (tr|A0A1Y2CKX0|A0A1Y2CKX0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORY47679.1} KW=Complete proteome; Reference proteome OX=329046 OS=Rhizoclosmatium globosum. GN=BCR33DRAFT_714771 OC=Chytriomycetaceae; Rhizoclosmatium.
Sequence
MATQNVGQLIANFHGKTLSAICFSEEQQVCDSETHQPIGHIKIDVGVTSYKECYFVSVVR
EINRVGEGQFMWTVSSYVSPELETLTESVYDVLTLPDGRVDEKITEAVKEIGQFDTGSYM
VITETMTGVEDPFETIVTLKKDDEQLLLSGAEFILNRILARSEAELEVTAYKYHSKALYK
AYYSTEQVQPEASPAQTPLSGQRPIQLETLTKISLTAEKENLNFVPTRRGSKLEAVKKEE
AQTDGLITTDFDSSFTAIVNKAISHDEGLNQGLVTTLSYEAKLTHSGLCLFLQGSGGFLE
LDYYAEKVGGSKKAVLAVPLEEGSQQINFGGNIELISEFKQRKAEIKRSHTQYIKEHPKL
QEIMSDYVQHILLKRPDDVYTFTQNWMTKPQP
Download sequence
Identical sequences A0A1Y2CKX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]