SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HBN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y2HBN7
Domain Number - Region: 54-96
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0968
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HBN7
Sequence length 218
Comment (tr|A0A1Y2HBN7|A0A1Y2HBN7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ30482.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_48391 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MHPPIYLFRRVRRPPFLALTVITGHVVIRLLVLATQQTMLLRARHQRPAASGSPPRQPTR
SMGVTTASLCLPRAQSHARVLAETVTCPRLPQWDTAAITIAATGVFIARVPQHSPSRSAA
RSALLAFSAAGAFRCLLRGCEASPPGDSGRQVESVWIRPFAARPSTATSKAVSAAELLLY
DGVIHQPSSFLIVPLASVHVITVARLAAVHEPHGATAA
Download sequence
Identical sequences A0A1Y2HBN7
jgi|Catan1|48391|gm1.1608_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]