SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HEH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y2HEH6
Domain Number - Region: 19-69
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000667
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HEH6
Sequence length 71
Comment (tr|A0A1Y2HEH6|A0A1Y2HEH6_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ32976.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_117697 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MVDLERRRNGRALQWTHGALTAAAARGHVHVLDWWLNQRHLQVEWVGLLTPALRGGHIKV
LEWWAASGLKM
Download sequence
Identical sequences A0A1Y2HEH6
jgi|Catan1|117697|e_gw1.10.67.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]