SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HEI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y2HEI7
Domain Number - Region: 6-52
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00288
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HEI7
Sequence length 110
Comment (tr|A0A1Y2HEI7|A0A1Y2HEI7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ32965.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_35092 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MDVAMQAACTKGNLVVIKWLVQSNQVEVQVTSAALGQAIRHGHSCVLDFIMACSGRGGML
CNRHLLDHSALTGAALSSPSPSTMLAWLARNNLAHFDSSTLAAACTSGTL
Download sequence
Identical sequences A0A1Y2HEI7
jgi|Catan1|35092|fgenesh1_kg.10_#_122_#_Locus17665v3rpkm0.00_PRE

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]