SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HJH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HJH0
Domain Number 1 Region: 383-517
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000105
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HJH0
Sequence length 669
Comment (tr|A0A1Y2HJH0|A0A1Y2HJH0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ34730.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_33557 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MHSMYLSSSLPMPSSATSPRPIQCEAIEVGFAALSLKHPLAATSAESDATTLTDELLNLV
LVHTIRSTRGKHNHARLGQLLVAAPAQQCPDLLSAVLTQAWWLDLDAASRNGAGGQATVH
ALDRLMTLARRGVWTLQYSRRGLAVAAKRADVPVLGWWYRQRTNPEIVAGSVFSFVDLTL
DDMVQSMHEHVAEAAVYEALHWFFVQHFQVDMAMVADHESFASASRGRTVNRQQAQRLIR
TAAMRGFETVLRGIALKIASPGVAAMGVDNWVRIVAGGHVKCADMVWTYAPIPESLGRRS
RDTLVGLTHAAFASGSSHMICWCANQFPAFTSANNVRHFGSSVAICAYIAGVAQCLTAAS
VGGHLGLVQELIRDLRASGNVDYLKDHDIAADEIIKLGHLEVVEWWDMHGKEFNIDLELQ
QAKYTMTLVVRAGNLPMFNWWWATTASTFGDDDDAQLLTKLISEAAKNGHVEMVNHLVAI
AKQQTTSKTDFLTQAIYGLVQAATESGNVAVLDWWLESENRMANQPVVVTVPPKLEWLKT
ASRLGHVRVLQWWLTVNSSEVSAWVPELVTAATCADQASTICFLLGERGPLDSESDLAVE
AGQVWAGFLAGISETKVQTMRGEVLALLLQRWPHVLRGHSRAGQVKQRLEQLSLVGLARY
WTRMFPEFE
Download sequence
Identical sequences A0A1Y2HJH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]