SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HP68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y2HP68
Domain Number - Region: 141-236
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00051
Family Pseudo ankyrin repeat 0.027
Further Details:      
 
Domain Number - Region: 184-196,272-346,388-446
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0106
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HP68
Sequence length 691
Comment (tr|A0A1Y2HP68|A0A1Y2HP68_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ35754.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_35389 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MNATNSNPHTQLQQVTADPVLTLELADLALAMAVQHAAVTSLWNPIVISQPLNALSRSAS
PLPTKVALMHLPHVDLDTATKLNNVDLLKFMLAWSKKPGGRPANYSHPMLLGMRASALAA
LDWWLDQSGLCFQRDLRGVLEACTLGRLNVLEWWKGRSFVGYHSRLENGKVPEVTVVISA
ATRAGRLDVLDWLWKHLPDAQAAFKQACQEESAIMEAVAQSRHDVAVTVAEWWLEKCRTE
SLGPMPSLAPVLLHALAKRCVALLEWCKSHRQVVEHYQAGRTTQRVYSAGQSALALAVVG
NALDWIDSLGIVPTKGEYAIATETACAIGNTDALKWLQDKGWLVGSRFHLLCSVTQQSEH
GFAIESRMLQTLQWIHDHAALDLDPEEEQYAVMMGDSVYRDLCTFGHVKVLDWLHSHGYQ
LDNGDWEHFFGEATNGQHLNVLEWLAAHTKASKKRLTEIATRLEWESHDLSIWKWWLARL
GALDAFARIIVAPAFYLPHENPHCTLILQLWLDSGAVLDYAACINSASIAGNVAVLDWFL
HVLGVPMEQFVSAFTGSVDVQAKFDRRRSSFSYTANVLLWWRSSIPQVHSLAHTTQLSKK
HATGSNPIKAHILTSMLKFPRFPMLDARLLVGEENVAMFMYLCKDPAVCDALRKGPALKF
ALLWAKQRQQEHVIEWWTSQSGFEMPEGWEW
Download sequence
Identical sequences A0A1Y2HP68
jgi|Catan1|35389|fgenesh1_kg.13_#_44_#_Locus15733v1rpkm2.02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]