SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HPW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HPW8
Domain Number 1 Region: 243-358,394-406
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000327
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number 2 Region: 31-89,161-339
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000919
Family Ankyrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HPW8
Sequence length 608
Comment (tr|A0A1Y2HPW8|A0A1Y2HPW8_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ36646.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_27212 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MLLDEVSAKGFVNVLDWWHNSSGDNVIGQTNPIQRACDGGHPQVLSWWWSHQHRGRLGER
FPGYKHDLFSLMEATRKGDMAILQWWFDNVFADDMEIMETHNAGAFRRQAIFMANSFQEL
IMAAGMFGLKEAVDFWVRVAEGYCGLDDSVMSALFACGRMDWIDEYLFDFDQSYDSADAI
HPCSFSAFSGNIQFIEACLGRFSLSPDDYEAVKFDMTVFASCMGQVHVLDWMHSRGMVDF
EVLTCDELTTFNYKDDFQLLLSNFKPTTEPYHVQQDLTDTLIHWLVYFGDLAVLEWWHRH
NSSDFEALMTRSEWPLFPSSLKSAIRQGHAHVVRFLFAHWRPSVLTQTDSSYLEEAALRG
HVDVFTTWGEAWGSKWHGPIHEGCINAIMFSALSQGHVEIVEWWMSTWPEAKFSAGLGNL
ILHYLKVGVPPKVLDWCLKNAHRFRWEGVIEYNLNPAYLTAKLSTKDTLRLISFNGQQCG
QARFEPMVDDNRSLLNAWRGQPLALQSLVTSGLLSERFDLDVAILADAGVAVYDWMLGFR
RQGRCRWTVRLGYGTLVGRGKWNELTWWAKKGLPVPPYKSKEDPWEKVELDFDAPLELDG
EDFAPEVQ
Download sequence
Identical sequences A0A1Y2HPW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]