SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HT92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HT92
Domain Number 1 Region: 128-243
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000017
Family Pseudo ankyrin repeat 0.0058
Further Details:      
 
Domain Number 2 Region: 491-538,584-594,636-658
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000759
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HT92
Sequence length 692
Comment (tr|A0A1Y2HT92|A0A1Y2HT92_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ36352.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_323497 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MILDLTDHILAISVRMLAMDGLLWDLHPVSSKSKTGPHSLVTLLHVLPRPLIPTATKTAL
AQLPSVSFATAAKVGDSWLLSHLLATTRAPACRHAMDLASEQGQVAALHWLYSHRFHLWL
SWTAGAVDKASANGHVHVLQWWVDHCGALGEVKYSDAAMHLAARHGHLHVLEWWLGTAHL
RYGLALKCPQILAHAAEGGHVEVLDWCVQHLLPLTTTTTTTRNTNALLVRAIENGHNHVL
HWWDANRAVVSNSTWLSQDMQAMSLAAASEGNLIALQCLASKCWYVGNQHDALSAAIVAG
NLDTVQWIHAHPPAPAIPAPLTKPGGRQRGGGYGRSSSISTPWRAAGATGSAVTSSNEPY
YLATKHGHAHLLPWLATCTGYKPHAKTNYKTIASAHGHLDVLQWWWTTHDLDAATKPVPR
RFEPMALIRATDAGHTHILQWWKSTGLLHPTSASALLGSGLLDAACAAGHVAVVDWWMTR
SGVAVEYDKHVMDEAAAHGRVHVLEWWVQSGYPLKYSQEALDGACAAGHVHVVRWWMEQA
RLGRVEVRYTQRAITGLARARPDVAALVWKRYGLALMGVSSLTHWGDLQFLDVWRDELGV
SVQVHSMAMDWHSGEGDVAKLEYLVQNHEPKSLVYTQAAMGRATAAGHMHVLEWWLSKWK
CGKISKLCVPADVLSVCKSAVVEQWWLESGLL
Download sequence
Identical sequences A0A1Y2HT92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]