SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HTT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HTT7
Domain Number 1 Region: 408-498
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000719
Family Pseudo ankyrin repeat 0.034
Further Details:      
 
Domain Number 2 Region: 209-290
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000929
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HTT7
Sequence length 717
Comment (tr|A0A1Y2HTT7|A0A1Y2HTT7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ38000.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_1483662 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MKDMNQVPKQTTQLAQPQPAASNSWAQSGPTLPLELAELVGILLIRLDAAATLWADRSAI
TSPLNLLPRSAAPGLTQAALINLPHVDMNSASLAGHVDLLDFMYAWSTRAGGKGRPIQYS
CNAPNPSSTWPEPLNVPLSVMDQVSGRPGLTRVLDWWWSKSKVLVVNWTEAAVDAAAANG
DLETLDWWWNTTGSLNGGQEQWFKYSQRAVDNASGNGHTPVLAWFVKQIGSHLGEAAIKY
SDIAMAQAAANGHVHVLRWWVEESGLQTKAQAVLDAAASTNQMDVLEWCLIQPRVLEQVK
IGGNIAKYDTLVTSAIRQGNRKLLSWFEERLPSHVRASWHKNPSESMAAAETGDLFAFQW
LQDRGWLFGTRQELISFAAGSGKLDVIEWVHKNVPSNNHQTIGWTSDEFTEATRNGDVEM
MDWLVSHGHVPWPSVCYYLAASYCGKASVMDWWSNYEGEFERYDLVSHAFKVAISKRRFE
ILDWWLKADSEHMSPDYLDEYWELLEDAGTQGDVEMIRWWCEVAGADFAFLLRDAVVAAS
AAGHISVLEYYAGYQGFELDLDHIAIAIAKASDAGHITCLDWWFKHVHAGGSGDGAVFVQ
AFNHSFQHGPGGKSLLWWTQVFRIQDYGLVPECPYHRFRVRADLVQLIGSLDSVYSLFFT
IRCGTWPRLTACDTDDTDPQLWITSPEAYRDSRPPKFTTPLSMPRPAGLPRAAICPL
Download sequence
Identical sequences A0A1Y2HTT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]