SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HX64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HX64
Domain Number 1 Region: 233-336
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000759
Family Pseudo ankyrin repeat 0.03
Further Details:      
 
Domain Number 2 Region: 89-190
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000955
Family Pseudo ankyrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HX64
Sequence length 657
Comment (tr|A0A1Y2HX64|A0A1Y2HX64_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ38544.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_44996 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MTPLALPLPLAELVLYYAPRVNHVTFNSISQVSRVLPRSLVPSAFLGLTLVVNGYLQCAR
PWTLLPKFSLTRLMQSLSPEDVVWLAQLLMPKLIQKHPTRPHNLLAWSFIDLATQHGILD
ALKLLHERAIPLPTAMILEKASHAGHIHVLEWLQDSIADFATVSDSKVGHAFRRAAQGGQ
QDVLSWWLDQRQFSADVIMSAAIGAAGIGHFGCVRELIQWTNGWEWGGDLFWRAASRGGN
VDILDLAIQHDAPLPIESVKVMDIASIARHVHVLDWWFLNAPDLSLLYTHKALDEASQAG
SLPVLNWWVRSGLELRFTPNALQEAVVNRHWDVVAWWQGLGVYKYIVNGEPSSVDAEELA
RNRLVTKDRITLASFGRLNWMRALCPLTAETPFDQVTHVQQVATMFGHVHILEAYKHLFD
GDEDRNDERHDHDSLALKTAIRNGHRACIQWVAQNLSCVSFLEYEWVECAETAVECANLG
IVVDLLSNPMIRRLLVGESGGISDLFVIACRNNKSDNATAILDFLFDQIGGCLSDSLTRS
ALKAGMEKDHLHVFQWWSSKDLHLLKETDSALFQDALLRGNEQIMDWFLNHGLQSSLDER
KAIHHATIDSLIAKRSFPTLHWIAERHRLLNIAPKDKMLLANELRKKGLWNGPADFF
Download sequence
Identical sequences A0A1Y2HX64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]