SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HX96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HX96
Domain Number 1 Region: 254-470
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000124
Family Ankyrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  A0A1Y2HX96
Domain Number - Region: 514-620
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000628
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number - Region: 654-734
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.085
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HX96
Sequence length 780
Comment (tr|A0A1Y2HX96|A0A1Y2HX96_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ38574.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_87631 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MHANRHPHPHRPPPQNANVNGAHPSTGTSTSTGTGAAKPAAPGRSLQLNQQLMALYPIHS
HPHHMAKNHHGHSHTHTLGQHHPHHHHQHQHQHQQLLPMSIVDTILALVPKCPTPKCSTY
MHILNVLHPLSVPRAFQSLVRFGDAYAPDLKPLASANKRVTSPSMDDPDDAESDGRFITT
DKLVRPRPRPTPTAAHGSSNGSGIGPRLASSTLPSPPLPPPTPSSIALARTGNEHLLALL
VPALKLDPLFTRRLVLSACTYGSLSTLNCLIALGLALDPFPLAITAASRGGHTSVLDWWI
NSGRPIECPRDAMVVASARGHVHVLEWWVKTTGGALVLNYDTSPAIAAACRGGHLGVVKW
WREFLGPAFVYFPEFGVCASEFGHVHLLKWFKAAGFAVGEGVEVSNMDLASMNGHVQVLE
FWRAELGNECKYTTRAMKFASRNGHLATLEWWRASGLELRFTPNVGELALKGGHKEIARW
WSNCPRFVALLRGDKPPDLLPTPTCDTSTLAPIDMDTLTAFGRRDLLDQLTWRALPSVST
PLAAIHAAQFGHTSVLEWWEPFNPMAAAANECLKIACRGNQINVLQWFHARGYAEGLADW
AECAGIAAANGHVSTLDWLRAAGKMPQSAPLGALGAELVTLVRDAIKGGEHTMVLSWCVE
NGYTFEFDEARAAEEAVVLACELGRVQVLEWWRKNLGGPPRGVVEGTTRFVDVASERGQH
LVLEWWATSGWELRFSEFAVRRARGRRVIEWWRRWVERESRQDEEVARVLDTMATVATED
Download sequence
Identical sequences A0A1Y2HX96
jgi|Catan1|87631|estExt_fgenesh1_pm.C_1880010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]