SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2I1C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2I1C5
Domain Number 1 Region: 122-207
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000102
Family Pseudo ankyrin repeat 0.023
Further Details:      
 
Domain Number 2 Region: 152-518
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000758
Family Ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2I1C5
Sequence length 655
Comment (tr|A0A1Y2I1C5|A0A1Y2I1C5_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ40676.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_1423573 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MDPLSLAADSLPLELVERLIAVAIHVLQCRPGRHGPDAWAYHDVTDTNPLTNPLHTLLCA
LGPRRDYPDITLAAFSRCWWVDLDCASAIGDIELLNVMDRLAQTAGARASLSRRPLQWTH
VAMDQSSKKGFVHVLDWWYKRFGAACWYTEAALTGAAEAGHLDALKWWVDRKDGLSCELN
NKILLHATLGGHLDICEWWLTHHCNERNPSDAYRMPVMHGLLHALVHAIRSHDTEFRMFH
WWLAQPFCRAPKVRHLKRASYNQLKDLQVAIWTHRETSTEVIARIPDLMDSVDVTLPVQV
AAGMCAGVLPGDGATKLLDAHAPRVWEAFVDLVAMASLAGHVHVLDWFVRQPLLGKLDQG
MLATLASMSISSALGAGHVHVLDWWVSACPWLDTVREALSLDTQSAVREASQAGHVHVLG
WWKSQSPFPYSCGPFTLQAAAQAGHVSVLEWWLESDKNKATELRARMNDVIRAASSHNQV
CVLDWWSQQQHFTKTSGDTMATITAASFSGSIDALQWWAATDWFVDWHERGNAMFSLDLP
RPQTFDWWIEYLWTDQTSLQDPERHSNFHYQLFLALVQSHCTILLHKYVRRFGFPNAASK
AVLPGEPHLADQVGLKSLQKGHVCTKPDPVVVETHISQTARHVKAWLTMKGIYSC
Download sequence
Identical sequences A0A1Y2I1C5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]