SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2LJY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2LJY6
Domain Number 1 Region: 321-436
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-32
Family cAMP-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 179-316
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-27
Family cAMP-binding domain 0.0000335
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000173
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2LJY6
Sequence length 458
Comment (tr|A0A1Y2LJY6|A0A1Y2LJY6_EPING) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} OX=105696 OS=Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens). GN=B5807_11409 OC=Didymellaceae; Epicoccum.
Sequence
MSLPPDYSNEIAALDREILKHKPHDILQFCASFFNRRLESQRAEFLLSQQHSSQQGRAEH
SFPGNNPFGTSPSSGGFAKSPMQRLEEEEEEGDMMASPTASSFAQAEQNRARGPDQPESS
FGSFGNFGGFGGSSKNQVTQMPPIAGGNTPSNYNASRRVSVSAESLNPTSADNDSFTPPF
HHKTEDQVARLRSAVSGNFLFSHLDDEQSTQVLGALHEKPIPAKGIKVITQGDVGDYFYV
VEKGAFDIHVNKSGKLEAGVDGLGAKVGSVGPGGSFGELALMYNAPRAATVISSEPSTLW
ALDRVTFRRILMDSAFQRRRMYEGFLEEVPLLSTLTPYERSKIADALETKKYPPGTEIIR
EGDIGESFYILESGEAQVYIRGNDQPVKRYNKGDYFGELALLNDAPRAASVISETEVKVA
MLKKNGFQRLLGPVEGIMRRNDPTKHEADGVDPLSRTY
Download sequence
Identical sequences A0A1Y2LJY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]