SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2M3P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2M3P4
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.31e-18
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0016
Further Details:      
 
Domain Number 2 Region: 79-157
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000372
Family Cold shock DNA-binding domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2M3P4
Sequence length 199
Comment (tr|A0A1Y2M3P4|A0A1Y2M3P4_EPING) Uncharacterized protein {ECO:0000313|EMBL:OSS49848.1} OX=105696 OS=Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens). GN=B5807_06065 OC=Didymellaceae; Epicoccum.
Sequence
MFILSTIQDLIQIKPQDFGKPSAEAIKDAINSKYSNKIVPGVGLCVALWDLVSATEGLIG
HGTGLVNINAEFRLAVFRPFRGEIIYGRIKTSTPEGIVIDLDFTSEIFVPYQNLFENSRF
EKSENVWVWNSDGTELFLDKGEPVLFRVEQEEWIDQRPTIEQRNENGEVVDERGTAWRVI
VSMLDNLRLQLLTLLFRAR
Download sequence
Identical sequences A0A1Y2M3P4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]