SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2TCL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2TCL3
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.75e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00014
Further Details:      
 
Domain Number 2 Region: 78-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-20
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2TCL3
Sequence length 171
Comment (tr|A0A1Y2TCL3|A0A1Y2TCL3_9PEZI) RNA polymerase Rpb7-like domain-containing protein {ECO:0000313|EMBL:OTA52843.1} OX=1001937 OS=Hypoxylon sp. EC38. GN=K449DRAFT_390691 OC=Hypoxylon.
Sequence
MFFLYNLERRVTLHPSYFGKNMHELVTSKLLKDVEGTCTGSYYIISIMDTFDISEGRILP
GSGLAEFTVGYRAVVWRPFKGETIDAIVVSVNQHGFFCEAGPLRIFVSTHLIPKEVKWDP
NATPPQFTNNEDTTIEVNTQVRVKIVGTRAEVGELWAIGSIKEDYLGTLQN
Download sequence
Identical sequences A0A1Y2TCL3 A0A1Y2UH98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]