SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2VBS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2VBS0
Domain Number 1 Region: 53-101,150-353
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.28e-31
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 417-587
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.96e-23
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 406-406
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000106
Family Pseudo ankyrin repeat 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2VBS0
Sequence length 864
Comment (tr|A0A1Y2VBS0|A0A1Y2VBS0_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OTA95009.1} OX=1001938 OS=Hypoxylon sp. CO27-5. GN=M434DRAFT_10238 OC=Hypoxylon.
Sequence
MEYLQTLPTELILGIIEYLDDIPDLRSLTATTRRLNYITTPVLYSLGAKKYPYLLSWACG
AGLLGVVEKLLVVGLSPNLPAVGVDSPEKLATHSENTLPFNMLDPSSVLNEVYHHQVWKQ
GPPRWLRREAQVPIYNPNVHSVAEEYIDGYKSYWFPLHAAAMSGSIEIIRLLFDFGAYLD
PPSRWLCGCSPDGIYGAMFCDWSLTSTYYWTPLHTALCCGNESTANYLLGLGASSNVELR
ERQSNALHWAARGGFLSTTKLLLEGVRNVSVDIPAPIGTTPLMWALGTERSIETMTCLIE
HGANIEAKVTPIWTRPTALTEACYNGWYKDATFLIDAGATSHSISPTEPSALDQCLISLN
AGLNRQERSEQENMIKRKTRLFKALDLRRKYNYKLGKLALRPCPNDLNEDAGFAAIMELM
KKLIHNGANINTSPAGTRHPLIRASAAHLIPIMELLLASGADVNQEDDKGSFPLLAAVPK
RRADWEDDVFGTVEFLLKHGAHSNKTNKSGRTTLMKICRHLQRSPSQLETVKLLVSYGAD
INIRSPFRKRLDLFWGYCNHDCSPLQVTFHERKYDILHYFMDQGAKILHEKADLSLMLED
FHYHSYEWEKEGEWDSGVEMNEPPNYTNVYPWQCRVNLCPPLRLLLSLDRSGWLAKDPRS
LFLSTRITKYPLLKSLLDAGASDASWIEYDKSCLSVFFPDVCVNGKPDFACAQRLVSIGA
DVNAIKGGHSLLSRTLYGVVSGLWVEDGGVTEFIKLLTFLVDNGVDPRREELEKFEEIVR
LDIIHGGFAPWEWDELCPNDTKLEDRVNLDDFEQNSRLDLRREVRRLFVVEGNKIVRRKL
LTYGDVALTEGDIDVVGASGSECS
Download sequence
Identical sequences A0A1Y2VBS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]