SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2WUP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2WUP5
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 4.71e-24
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2WUP5
Sequence length 131
Comment (tr|A0A1Y2WUP5|A0A1Y2WUP5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OTB12586.1} OX=1001832 OS=Daldinia sp. EC12. GN=K445DRAFT_14735 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Hypoxylaceae; Daldinia.
Sequence
MGHLSNDEFFVKLTELFDQKKGKDHGSIVLVQKRLSHDQPVPEPTSDAVLPDLHPPQPMP
VLIRATNAKGKKRREDKVKLSTVVEPDALPAFFDRYAEVCKAGMATLKPRDRSKRKGKAK
KKKGAAIPAGP
Download sequence
Identical sequences A0A1Y2WUP5
jgi|DalEC12_1|14735|fgenesh1_pg.28_#_123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]