SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2X4Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y2X4Z4
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily F-box domain 0.00222
Family F-box domain 0.01
Further Details:      
 
Domain Number - Region: 106-176
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00824
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2X4Z4
Sequence length 241
Comment (tr|A0A1Y2X4Z4|A0A1Y2X4Z4_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OTB16507.1} OX=1001832 OS=Daldinia sp. EC12. GN=K445DRAFT_10803 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Hypoxylaceae; Daldinia.
Sequence
MSGNRSRLLGLPLEIFRMIAEFLIAPHDYFHLMLTCRSLWNRDGDVLTSCIVRDARLLHA
NVMAGQYSDLRQWPPNYEPIVYWCLRTRQAIDIAIGIIERYYWVYPDAVTGSRNTRLHSA
AAYAIAADYFEAFELMLDMRVIPSLDVLGDQYMTWAVELADDIEIARWLVDRGVRAKPRH
MYVLHDRGLVPWRSQDWHYFMFHSSQAGGINLDPEDDSDTDSDDDSDDNSDDNSDTSMDG
L
Download sequence
Identical sequences A0A1Y2X4Z4
jgi|DalEC12_1|10803|fgenesh1_pg.9_#_74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]