SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3BDF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3BDF3
Domain Number 1 Region: 8-57
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000929
Family Pseudo ankyrin repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3BDF3
Sequence length 58
Comment (tr|A0A1Y3BDF3|A0A1Y3BDF3_EURMA) Uncharacterized protein {ECO:0000313|EMBL:OTF77215.1} KW=Complete proteome; Reference proteome OX=6958 OS=Euroglyphus maynei (Mayne's house dust mite). GN=BLA29_012573 OC=Analgoidea; Pyroglyphidae; Pyroglyphinae; Euroglyphus.
Sequence
METSAERIRQAVRDGYLDILRNATRKECNHPNDDGMTATHWASYCGQLNALRIIVGRG
Download sequence
Identical sequences A0A1Y3BDF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]