SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3DM82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3DM82
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.44e-31
Family Nip7p homolog, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 96-171
Classification Level Classification E-value
Superfamily PUA domain-like 1.55e-20
Family PUA domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3DM82
Sequence length 180
Comment (tr|A0A1Y3DM82|A0A1Y3DM82_PLAKN) 60S ribosome subunit biogenesis protein NIP7 homolog {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome OX=5850 OS=Plasmodium knowlesi. GN=PKNOH_S110085300 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MRPLNDNETMLVFKKLSKYVGNNLLSMLSYNNEEYVLRLHRSSVYFVRAELAKQAEAIIN
KNSLISLGICLGKFTKANNFFIKITSLSFLNEFCIHKIWLKESGEKNFLFGNNVLKSHLL
KVSDNIKKGDGIIVLSMNDSPIGFGISIRNTQDIKILNVTDIVLIHQGDVGEYLRSEATI
Download sequence
Identical sequences A0A193RGM0 A0A1G4HH34 A0A1Y3DM82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]