SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3E948 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3E948
Domain Number 1 Region: 52-166
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.1e-37
Family Frizzled cysteine-rich domain 0.0000769
Further Details:      
 
Domain Number 2 Region: 175-295
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000106
Family Tissue inhibitor of metalloproteinases, TIMP 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3E948
Sequence length 352
Comment (tr|A0A1Y3E948|A0A1Y3E948_9BILA) Fz domain protein {ECO:0000313|EMBL:OUC41654.1} OX=6335 OS=Trichinella nativa. GN=D917_03212 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MFRLFFNWIIIRRIIIIAQFDNHIQAISSWSSGMDTYMSESWAVLSRMPQPSCVDIPRNF
TLCHGIDYARMRLPNLVDHETLDEAVQQAAPWISLLRLNCHPDTQRFLCSLFAPVCLERA
IYPCRSLCEAVKSGCEKRMQMYGFPWPEMLNCNKFPITNDMCIQPHENYQVNKSCTSCNQ
VGTYENILDHFCRSDLVLKVKLKSVSSNHIVVQKARSIKPRETEANLRQNDVELKLQLTE
NNENCPCSSAKAHRNKRYLAMAYHGRNGVLVLNLLLPWRKEKKALKMFRKLDCKTLGTQI
RERARRERRKKLRAKAKAAAARLGLKMPNPRIITITCSFLSVRDLKQFDDKQ
Download sequence
Identical sequences A0A1Y3E948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]