SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3MQE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3MQE8
Domain Number 1 Region: 58-158,341-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000191
Family Ankyrin repeat 0.0061
Further Details:      
 
Domain Number 2 Region: 289-318,350-479
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000759
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3MQE8
Sequence length 546
Comment (tr|A0A1Y3MQE8|A0A1Y3MQE8_PIRSE) Uncharacterized protein {ECO:0000313|EMBL:OUM56282.1} KW=Complete proteome; Reference proteome OX=73868 OS=Piromyces sp. (strain E2). GN=PIROE2DRAFT_19177 OC=Neocallimastigales; Neocallimastigaceae; Piromyces.
Sequence
MINIKKAAHNITKRTITYEFYQLLQNNDVSEIKKFLQNNDLTVLDIRDYTKEIVPDVLVT
AVEQNCSTEMIEYIIEEGVYLDLDYEVDFEEKGYKSPLFTAIKNEFYNIADVLIAHGADI
NGEIQNTDIITYLNCLGVLNHTILTYILNHGYDVDSLDAFSINSLRVKHVQTIFDIFTTA
KIDIRNDWYMEAIHKKNYEMLALFITYDPKGLEDGFTKTLSFLKTYDLKNHTSRKNTFLN
KVKKQSISLTIPAALLEKVMIPDIKRKRQHLKQLIKKNEMKAFEAYVIQNKTPLREFNTE
KFDILIYAIEQNISLEWIKFIGKLGPYYNFNYTVQTKSEPRYGTPTSLDTDYYKSPLTVA
IDHQRFDIADYLQENGAKLFTDWVIRSRSQKYKTHIDILEYLYRNKNLNDSTLSYLYSQQ
KHTNDLYPVKINAVEEAIELKETEMAKAVIETFHLPIMTNWYRIALKSGNAAMLEYMLER
DQRDEEQVLSQLNEVIYNENFNEEAFIRATDLNNKNMSVALRKIFMTKKFCFVVNNINEQ
LIKLEA
Download sequence
Identical sequences A0A1Y3MQE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]