SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3MXX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3MXX0
Domain Number 1 Region: 5-242
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-32
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 527-866
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-29
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 145-365,409-476
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-28
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 968-1175
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.48e-18
Family Ankyrin repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 869-949
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000209
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3MXX0
Sequence length 1342
Comment (tr|A0A1Y3MXX0|A0A1Y3MXX0_PIRSE) Uncharacterized protein {ECO:0000313|EMBL:OUM59012.1} KW=Complete proteome; Reference proteome OX=73868 OS=Piromyces sp. (strain E2). GN=PIROE2DRAFT_15580 OC=Neocallimastigales; Neocallimastigaceae; Piromyces.
Sequence
MLGLIFEFLVTHGINLDINEQNSNGDYPLLSAVLLNNIDMVKYIVEYAERINTVLKINEI
DKDGGYPFLFSIENQNIQIVKLLIEYAERYGIILDINKKDNNGSYPLYASILNNNNELVT
IVLQYAYGNGIVININEKDEHGNFPLLWAVKRNNITMMKSIIDYASKINFSLKINEIDDN
GGDDPLLLSIFSNNIELVKLIIRYAIYNSINLNINDRNNDGYNPFLLSISNNNLKITKLI
MEYADKNNVILKINEKDINKSYSLLRAIYKQNIEMVKLIIEYADRNKITLTINEKDMNGN
YPLYWATQTNKIDIVKLIIDYANKNNIILNINEKGSDGNYPLYFIISNNNTEMLKLIIDY
ANKYNIILNTNIKVNDGNFLLSSMISNNSIGMFKLILNYAKENKVFLNFNEKGKDGNYPF
LRIISNNNIEMFKLVMNYVNKNKIILNVNEKNRNGDYPLLKIISNNNFEMFSLFKDYVSK
NNILLNINEKDENGQNRVFETIINTTITNDNNNNNNFNPFIRNVSRNSNEMIESIINYAK
DNNIIFNICEKDKNDNNIILNVNEKDSNGVSPFLSFIYHNNIEMFKLILDYANKNNIVLS
INEKDNHGNYPLLNIIYNKNVEMCKLLLNYADKNNIALNINEKNKNGDYPFLWTISNNNN
IEMFKSIMDYANKNNIVLNTNEKDKNGNYPLLWATSNDNIDIVKLIINYANKNNINLEIN
DRNVKGSNPLLESIITNSNIELAKLIIDYADKNNIILNINEKDSKGDYPLLWSISLNDIE
MIKFIMNYANKNGIILNINEKDNKGNYPLLWSIYYNSVEIVELIIDYANINNINLNINDR
NSEGWNPFLKTIFNNNTEMFKLIMDYASIKNIILNVNEKDKDGNYPLLKIISNKNVDMCK
LIMDYADKNNIILNINEKDKNGYNKLFEVIFNININSNDNSYLEDGSKVVIDMYKLIMDY
TNKNNIILDINGKDKNGNYPLLRSISCNNIEMVNIIINYATNNNIILNINEKNDEGDYPL
LRIISNKNVEMCKLLLEYADKNNIVLNINEKDKDGYNKLFEVITNTVINVRNNLNPYIDD
HSRIIIEMFKLIIDYAGKNKIILNINEKGNNGSYPLLWLIYNNKIEMVKLIIEYANKNNI
NLNINDENINGYNPLLLTLCNNNIEMFKLIMDYANTNNIILNIHEEKMENIMKTNNSGIK
NISEVKQEIIKLLYDNYNMHKITIVFNENSKILKLFKEISNSPSNPHPTTHPQSDPHFKP
DLHSQPDTNSQSDPNSQHIYNSQSSPDSPLISNTKRINDSNLVFNSQMNTTKSRARTLSI
FNNDNEEEKEEDYIEIEYYNVV
Download sequence
Identical sequences A0A1Y3MXX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]