SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3NG10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3NG10
Domain Number 1 Region: 338-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-41
Family Ankyrin repeat 0.00073
Further Details:      
 
Domain Number 2 Region: 594-783
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-31
Family Ankyrin repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 39-174
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000196
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3NG10
Sequence length 810
Comment (tr|A0A1Y3NG10|A0A1Y3NG10_PIRSE) Uncharacterized protein {ECO:0000313|EMBL:OUM63993.1} KW=Complete proteome; Reference proteome OX=73868 OS=Piromyces sp. (strain E2). GN=PIROE2DRAFT_9380 OC=Neocallimastigales; Neocallimastigaceae; Piromyces.
Sequence
MITANIIEETKNITKLKDEKRNEIKELIKHNHNFGVFEKYITEKCIILKDLNKEDFDVLL
YSIENDASPEIIKYIVCQCKYNDLNYHIIEDKTLKAPLFSSIGKNNFEISKLLIQKNADI
NYFNNDIINYLYNQGLLNKKNLRFILNNEFNWKAITTDLLNNLVEKEENDFLEIIFKHYI
YNKSFILDLLKIYSQKTSLSNEQLNDILSKERNKFHITIEMYDKANEDTILNYNIQKLLF
EHDNDDSYLVIRKINEYDLLKKAVILNDYQFVKEILQYKKFNCTDYNFYSIMNECKSNGN
VYKLLIQSLLDMIPVIQDDSSKRMYDPKYFNLLLNKIIRVSMNNKNFFYYLIESNKYKSH
MDLNEKDLNDEYPIFVAFRYGGTEIFEYLLKYNIDLNVKDNNNNTLLSLAVASGSKKILN
HLLKHQVNINVKDNNGIYPLMKAIMKNDFDMVVLLTEHGKKHNINMNIHDINGNTPLTLS
YKLNYKNIFKYLLNYYDINEKDSNGNNILYYVIENKDIIIMNYLIHNNIDITSKNKYMIS
CLDLAIIKGYEVLFPLLKCQFISSWSVNIQNSNDEIPLVSILKGSKYSLKEKSYIVEKLI
SKGSNVNSSDKDGNTSLIYAIQNKSLSIVKLLVENGANVNYYNPYTNKTILKYAVDSGVL
DIVKYLVTYNASIYCNNPNAIPIFGKTIVDINEIYIDIVVYLIPKLRICDVNGNMVYKII
RNGKLYLLKNLITNNLDVNLKDYEGDSALANAIYYRNEDIVNYLIQCKGIDFHSKNNRGQ
SIADRNEEFFGKEDKYKAIYNKIKNCIETN
Download sequence
Identical sequences A0A1Y3NG10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]